viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL51[Gene ID: 1487340 ]
Tegument protein UL51
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MASLLGVLCGWGTRPEEQQYEMIRAAAPPSEAEPRLQEALAVVNALLPAPITLDDALESLDDTRRLVKARALARTYHACMVNLERLARHHPGLEGSTIDG
AVAAHRDKMRRLADTCMATILQMYMSVGAADKSADVLVSQAIRSMAESDVVMEDVAIAERALGLSTSALAGGTRTAGLGATEAPPGPTRAQAPEVASVPV
THAGDRSPVRPGPVPPADPTPDPRHRTSAPKRQASSTEAPLLLA
244
Not Available
Not Available
01-05-1997
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays several roles during the time course of infection, including egress of virus particles from the perinuclear space and secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes.
Not Available
Virion tegument . Host cytoplasm . Host Golgi apparatus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available