viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL45
Envelope protein UL45 (18 kDa protein)
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MAFRASGPAYQPLAPAASPARARVPAVAWIGVGAIVGAFALVAALVLVPPRSSWGLSPCDSGWQEFNAGCVAWDPTPVEHEQAVGGCSAPATLIPRAAAK
HLAALTRVQAERSSGYWWVNGDGIRTCLRLVDSVSGIDEFFEELAIRICYYPRSPGGFVRFVTSIRNALGLP
172
Not Available
Not Available
01-05-1997
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Important virulence factor of HSV neurotropism. Seems to be required for glycoprotein B-induced fusion (By similarity). Dispensable for growth in vitro.
Not Available
♦ Virion membrane
♦ Single-pass type II membrane protein . Note=In transfected cells, it is retained within the ER. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available