viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL42[Gene ID: 1487329 ]
DNA polymerase processivity factor (DNA-binding protein UL42) (Polymerase accessory protein) (PAP)
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MAHLPGGAAAAPLSEDAIPSPRERTEDWPPCQIVLQGAELNGILQAFAPLRTSLLDSLLVVGDRGILVHNAIFGEQVFLPLDHSQFSRYRWGGPTAAFLS
LVDQKRSLLSVFRANQYPDLRRVELTVTGQAPFRTLVQRIWTTASDGEAVELASETLMKRELTSFAVLLPQGDPDVQLRLTKPQLTKVVNAVGDETAKPT
TFELGPNGKFSVFNARTCVTFAAREEGASSSTSAQVQILTSALKKAGQAAANAKTVYGENTHRTFSVVVDDCSMRAVLRRLQVGGGTLKFFLTADVPSVC
VTATGPNAVSAVFLLKPQRVCLNWLGRSPGSSTGSLASQDSRAGPTDSQDSSSEPDAGDRGAPEEEGLEGQARVPPAFPEPPGTKRRHPGAEVVPADDAT
KRPKTGVPAAPTRAESPPLSARYGPEAAEGGGDGGRYACYFRDLQTGDASPSPLSAFRGPQRPPYGFGLP
470
Not Available
Not Available
01-05-1997
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays an essential role in viral DNA replication by acting as the polymerase accessory subunit. Associates with the viral polymerase to increase its processivity and forms high-affinity direct interactions with DNA. Facilitates the origin-binding protein loading onto DNA thus increasing its ability to assemble into a functional complex capable of unwinding duplex DNA (By similarity).
Not Available
Host nucleus .
Not Available
MOTIF 385 404 Bipartite nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available