viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
TK UL23[Gene ID: 1487307 ]
Thymidine kinase (EC 2.7.1.21)
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MASHAGQQHAPAFGQAARASGPTDGRAASRPSHRQGASGARGDPELPTLLRVYIDGPHGVGKTTTSAQLMEALGPRDNIVYVPEPMTYWQVLGASETLTN
IYNTQHRLDRGEISAGEAAVVMTSAQITMSTPYAATDAVLAPHIGGEAVGPQAPPPALTLVFDRHPIASLLCYPAARYLMGSMTPQAVLAFVALMPPTAP
GTNLVLGVLPEAEHADRLARRQRPGERLDLAMLSAIRRVYDLLANTVRYLQRGGRWREDWGRLTGVAAATPRPDPEDGAGSLPRIEDTLFALFRVPELLA
PNGDLYHIFAWVLDVLADRLLPMHLFVLDYDQSPVGCRDALLRLTAGMIPTRVTTAGSIAEIRDLARTFAREVGGV
376
Not Available
Not Available
01-05-1997
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Catalyzes the transfer of the gamma-phospho group of ATP to thymidine to generate dTMP in the salvage pathway of pyrimidine synthesis. The dTMP serves as a substrate for DNA polymerase during viral DNA replication. Allows the virus to be reactivated and to grow in non-proliferative cells lacking a high concentration of phosphorylated nucleic acid precursors.
2.7.1.21  
GO:0004797  ;   GO:0005524  ;   GO:0006230  ;   GO:0071897  
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
ACT_SITE 84 84 Proton acceptor.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available