Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL20[Gene ID: 24271455 ]
Protein UL20
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MTMRDDVPLLDRELVDEAACGGEDGELPLDEQFSLSSYGTSDFFVSSAYSRLPPHTQPVFSKRVVMFAWSFLVLKPLELVAAGMYYGWTGRAVAPACIIA
AVLAYYVTWLARALLLYVNIKRDRLPLSPPVFWGLCVIMGGAALCALVAAAHETFSPDGLFHWITASQLLPRTDPLRARSLGIACAAGAAMWVAAADCFA
AFTNFFLARFWTRAILKAPVAF
AVLAYYVTWLARALLLYVNIKRDRLPLSPPVFWGLCVIMGGAALCALVAAAHETFSPDGLFHWITASQLLPRTDPLRARSLGIACAAGAAMWVAAADCFA
AFTNFFLARFWTRAILKAPVAF
222
Not Available
Not Available
01-05-1997
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Plays an essential role in egress of virus particles from the nucleus, cytoplasmic envelopment and virus-induced cell fusion. Forms a functional protein complex with gK and this interaction is absolutely essential for their coordinate intracellular transport, gK glycosylation, expression on host cell surface, and function. Together, they modulate gB-mediated virus-induced cell fusion and virion egress and therefore actively participate in these processes (By similarity).
Not Available
♦ Virion . Host cell membrane
♦ Multi-pass membrane protein . Host endosome membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Host nucleus membrane
♦ Multi-pass membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported with gK to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN) (By similarity). .
♦ Multi-pass membrane protein . Host endosome membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Host nucleus membrane
♦ Multi-pass membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported with gK to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN) (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available