Reviewed
Homo Sapiens (Human) [TaxID: 9606]
TRX2 UL18[Gene ID: 1487301 ]
Triplex capsid protein 2
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
MITDCFEADIAIPSGISRPDAAALQRCEGRVVFLPTIRRQLALADVAHESFVSGGVSPDTLGLLLAYRRRFPAVITRVLPTRIVACPVDLGLTHAGTVNL
RNTSPVDLCNGDPVSLVPPVFEGQATDVRLESLDLTLRFPVPLPTPLAREIVARLVARGIRDLNPDPRTPGELPDLNVLYYNGARLSLVADVQQLASVNT
ELRSLVLNMVYSITEGTTLILTLIPRLLALSAQDGYVNALLQMQSVTREAAQLIHPEAPMLMQDGERRLPLYEALVAWLAHAGQLGDILALAPAVRVCTF
DGAAVVQSGDMAPVIRYP
RNTSPVDLCNGDPVSLVPPVFEGQATDVRLESLDLTLRFPVPLPTPLAREIVARLVARGIRDLNPDPRTPGELPDLNVLYYNGARLSLVADVQQLASVNT
ELRSLVLNMVYSITEGTTLILTLIPRLLALSAQDGYVNALLQMQSVTREAAQLIHPEAPMLMQDGERRLPLYEALVAWLAHAGQLGDILALAPAVRVCTF
DGAAVVQSGDMAPVIRYP
318
Not Available
Not Available
01-05-1997
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Structural component of the T=16 icosahedral capsid. The capsid is composed of pentamers and hexamers of major capsid protein/MCP, which are linked together by heterotrimers called triplexes. These triplexes are formed by a single molecule of triplex protein 1/TRX1 and two copies of triplex protein 2/TRX2. Additionally, TRX1 is required for efficient transport of TRX2 to the nucleus, which is the site of capsid assembly.
Not Available
Virion . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available