viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL16
Cytoplasmic envelopment protein 2
Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 2 (HHV-2) (Human Herpes Simplex Virus 2)> Human Herpesvirus 2 (strain HG52) (HHV-2) (Human Herpes Simplex Virus 2)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MAQRALWRPQATPGPPGAAAPPGHRGAPPDARAPDPGPEADLVARIANSVFVWRVVRGDERLKIFRCLTVLTEPLCQVALPDPDPERALFCEIFLYLTRP
KALRLPSNTFFAIFFFNRERRYCATVHLRSVTHPRTPLLCTLAFGHLEAASPPEETPDPAAEQLADEPVAHELDGAYLVPTDTAPESGACCALGPGAWWH
LPGGRIYCWAMDDDLGSLCPPGSRARHLGWLLSRITDPPGGGGACAPTAHIDSANALWRAPAVAEACPCVAPCMWSNMAQRTLAVRGDASLCQLLFGHPV
DAVILRQATRRPRITAHLHEVVVGRDGAESVIRPTSAGWRLCVLSSYTSRLFATSCPAVARAVARASSSDYK
372
Not Available
Not Available
01-05-1997
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a critical role in cytoplasmic virus egress. Participates in the final step of tegumentation and envelope acquisition within the host cytoplasm by directly interacting with the capsid. Upon virion binding to target cell, a signaling cascade is triggered to disrupt the interaction with the capsid, thereby preparing capsid uncoating.
Not Available
Virion tegument . Host cytoplasm , . Host nucleus , . Note=Localizes in the host nucleus up to 18 hours postinfection, but at later times localizes to punctate, cytoplasmic structures. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available