viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
SH
Small hydrophobic protein
Mumps Virus (strain SBL-1) (MuV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Paramyxoviridae> Rubulavirus> Mumps Rubulavirus> Mumps Virus Genotype A> Mumps Virus (strain SBL-1) (MuV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MPANQPPLYLTFLLLILLYLIITLYVWTILTINHKTAVRYAALYQRSCSRWGFDQSL
57
Not Available
Not Available
15-03-2005
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of the host NF-kappa-B pathway. This inhibition occurs at the receptor level, by preventing the signaling of TNFR1 as well as IL-1R and TLR3.
Not Available
GO:0016021  ;   GO:0020002  ;   GO:0039644  ;   GO:0055036  
♦ Virion membrane
♦ Single-pass membrane protein . Host cell membrane
♦ Single-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available