Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Early E3 18.5 kDa glycoprotein (E3-19K) (E3gp 19 kDa) (E19) (GP19K)
Human Adenovirus B Serotype 11 (strain Slobiski) (HAdV-11) (Human Adenovirus 11P (strain Slobiski))
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus B> Human Adenovirus B2> Human Adenovirus 11> Human Adenovirus B Serotype 11 (strain Slobiski) (HAdV-11) (Human Adenovirus 11P (strain Slobiski))
Various pathway(s) in which protein is involved
Not Available
Not Available
MGPILVLLVLLSLLEPGSANYDPCLDFDPENCTLTFAPDTSRICGVLIKCGWECRSVEITHNNKTWNNTLSTTWEPGVPEWYTVSVRGPDGSIRISNNTF
IFSEMCDLAMFMSKQYSLWPPSKDNIVTFSIAYCLCACLLTALLCVCIHLLVTTRIKNANNKEKMP
IFSEMCDLAMFMSKQYSLWPPSKDNIVTFSIAYCLCACLLTALLCVCIHLLVTTRIKNANNKEKMP
166
Not Available
Not Available
01-02-2005
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Binds and retains class I heavy chains in the endoplasmic reticulum during the early period of virus infection, thereby impairing their transport to the cell surface. Also delays the expression of class I alleles that it cannot affect by direct retention. Binds transporters associated with antigen processing (TAP) and acts as a tapasin inhibitor, preventing class I/TAP association. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes (By similarity).
Not Available
♦ Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein.
♦ Single-pass type I membrane protein.
Not Available
MOTIF 162 166 Di-lysine motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available