viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Early E3 18.5 kDa glycoprotein (E3-19K) (E3gp 19 kDa) (E19) (GP19K)
Human Adenovirus B Serotype 11 (strain Slobiski) (HAdV-11) (Human Adenovirus 11P (strain Slobiski))
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus B> Human Adenovirus B2> Human Adenovirus 11> Human Adenovirus B Serotype 11 (strain Slobiski) (HAdV-11) (Human Adenovirus 11P (strain Slobiski))
Various pathway(s) in which protein is involved
Not Available
Not Available
MGPILVLLVLLSLLEPGSANYDPCLDFDPENCTLTFAPDTSRICGVLIKCGWECRSVEITHNNKTWNNTLSTTWEPGVPEWYTVSVRGPDGSIRISNNTF
IFSEMCDLAMFMSKQYSLWPPSKDNIVTFSIAYCLCACLLTALLCVCIHLLVTTRIKNANNKEKMP
166
Not Available
Not Available
01-02-2005
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Binds and retains class I heavy chains in the endoplasmic reticulum during the early period of virus infection, thereby impairing their transport to the cell surface. Also delays the expression of class I alleles that it cannot affect by direct retention. Binds transporters associated with antigen processing (TAP) and acts as a tapasin inhibitor, preventing class I/TAP association. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes (By similarity).
Not Available
GO:0005537  ;   GO:0016021  ;   GO:0039504  ;   GO:0039591  ;   GO:0044167  
♦ Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein.
Not Available
MOTIF 162 166 Di-lysine motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available