Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Sus Scrofa (Pig) [TaxID: 9823]
HE[Gene ID: 3077359 ]
♦Hemagglutinin-esterase-fusion glycoprotein (HEF) (EC 3.1.1.53) [Cleaved into: Hemagglutinin-esterase-fusion glycoprotein chain 1 (HEF1)
♦ Hemagglutinin-esterase-fusion glycoprotein chain 2 (HEF2)]
♦ Hemagglutinin-esterase-fusion glycoprotein chain 2 (HEF2)]
Influenza C Virus (strain C/Ann Arbor/1/1950)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Gammainfluenzavirus> Influenza C Virus> Influenza C Virus (strain C/Ann Arbor/1/1950)
NC_006307.2 ; AB126193.2 ; NC_006308.2 ; AB126196.2 ; NC_006309.2 ; AB126191.2 ; NC_006310.2 ;
AB283001.1 ; NC_006311.1 ; AB126195.1 ; NC_006312.2 ; AB126191.2 ; NC_006306.2 ; AB283001.1
AB283001.1 ; NC_006311.1 ; AB126195.1 ; NC_006312.2 ; AB126191.2 ; NC_006306.2 ; AB283001.1
Various pathway(s) in which protein is involved
Not Available
MFFSLLLMLGLTEAEKIKICLQKQVNSSFSLHNGFGGNLYATEEKRMFELVKPKAGASVLNQSTWIGFGDSRTDKSNSAFPRSADVSAKTADKFRSLSGG
SLMLSMFGPPGKVDYLYQGCGKHKVFYEGVNWSPHAAINCYRKNWTDIKLNFQKNIYELASQSHCMSLVNALDKTIPLQATAGVAKNCNNSFLKNPALYT
QEVNPSVEKCGKENLAFFTLPTQFGTYECKLHLVASCYFIYDSKEVYNKRGCDNYFQVIYDSSGKVVGGLDNRVSPYTGNSGDTPTMQCDMLQLKPGRYS
VRSSPRFLLMPERSYCFDMKEKGPVTAVQSIWGKGRESDHAVDQACLSTPGCMLIQKQKPYIGEADDHHGDQEMRELLSGLDYEARCISQSGWVNETSPF
TEEYLLPPKFGRCPLAAKEESIPKIPDGLLIPTSGTDTTVTKPKSRIFGIDDLIIGLLFVAIVEAGIGGYLLGSRKVSGGGVTKESAEKGFEKIGNDIQI
LRSSTNIAIEKLNDRISHDEQAIRDLTLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWVIDNNICDQSCQNFIF
KFNETAPVPTIPPLDTKIDLQSDPFYWGSSLGLAITAAISLAALVISGIAICRTK
SLMLSMFGPPGKVDYLYQGCGKHKVFYEGVNWSPHAAINCYRKNWTDIKLNFQKNIYELASQSHCMSLVNALDKTIPLQATAGVAKNCNNSFLKNPALYT
QEVNPSVEKCGKENLAFFTLPTQFGTYECKLHLVASCYFIYDSKEVYNKRGCDNYFQVIYDSSGKVVGGLDNRVSPYTGNSGDTPTMQCDMLQLKPGRYS
VRSSPRFLLMPERSYCFDMKEKGPVTAVQSIWGKGRESDHAVDQACLSTPGCMLIQKQKPYIGEADDHHGDQEMRELLSGLDYEARCISQSGWVNETSPF
TEEYLLPPKFGRCPLAAKEESIPKIPDGLLIPTSGTDTTVTKPKSRIFGIDDLIIGLLFVAIVEAGIGGYLLGSRKVSGGGVTKESAEKGFEKIGNDIQI
LRSSTNIAIEKLNDRISHDEQAIRDLTLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWVIDNNICDQSCQNFIF
KFNETAPVPTIPPLDTKIDLQSDPFYWGSSLGLAITAAISLAALVISGIAICRTK
655
Not Available
Not Available
12-12-2006
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Binds to the N-acetyl-9-O-acetylneuraminic acid residues on the cell surface, bringing about the attachment of the virus particle to the cell. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induce an irreversible conformational change in HEF2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore. Displays a receptor-destroying activity which is a neuraminidate-O-acetyl esterase. This activity cleaves off any receptor on the cell surface, which would otherwise prevent virions release. These cleavages prevent self-aggregation and ensure the efficient spread of the progeny virus from cell to cell.
3.1.1.53
GO:0001681 ; GO:0016021 ; GO:0019031 ; GO:0019062 ; GO:0019064 ;
GO:0020002 ; GO:0039654 ; GO:0046789 ; GO:0055036 ; GO:0075509
GO:0020002 ; GO:0039654 ; GO:0046789 ; GO:0055036 ; GO:0075509
♦ Virion membrane
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein .
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
♦ACT_SITE 71 71 Nucleophile.
♦ ACT_SITE 366 366 Charge relay system.
♦ ACT_SITE 369 369 Charge relay system.
♦ ACT_SITE 366 366 Charge relay system.
♦ ACT_SITE 369 369 Charge relay system.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available