Reviewed
Homo Sapiens (Human) [TaxID: 9606]
MVA126L ACAM3000_MVA_126[Gene ID: 3707533 ]
Core protein A15
Vaccinia Virus (strain Ankara) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Ankara) (VACV)
9601507 ;
Various pathway(s) in which protein is involved
Not Available
MFVDDNSLIIYSTWPSTLSDSSGRVIVMPDNRSFTFKEGFKLDESIKSILLVNPSSIDLLKIRVYKHRIKWMGDIFVLFEQENIPPPFRLVNDK
94
Not Available
Not Available
07-12-2004
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Late protein which is a part of a large complex required for early virion morphogenesis. This complex participates in the formation of virosomes and the incorporation of virosomal contents into nascent immature virions. A15 is required for the stability and kinase activity of F10 (By similarity).
Not Available
Host cytoplasm . Virion. Note=Localizes in cytoplasmic virus factories and present in the virion core. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available