viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
MVA077L ACAM3000_MVA_077 G7L[Gene ID: 3707541 ]
Assembly protein G7
Vaccinia Virus (strain Ankara) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Ankara) (VACV)
Various pathway(s) in which protein is involved
Not Available
MAAEQRRSTIFDIVSKCIVQSVLRDISINSEYIESKAKQLCYCPASKKESVINGIYNCCESNIEIMDKEQLLKILDNLRCHSAHVCNATDFWRLYNSLKR
FTHTTAFFNTCKPTILATLNTLITLILSNKLLYAAEMVEYLENQLDSSNKSMSQELAELLEMKYALINLVQYRILPMIIGEPIIVAGFSGKEPISDYSAE
VERLMELPVKTDIVNTTYDFLARKGIDTSNNIAEYIAGLKIEEIEKVEKYLPEVISTIANSNIIKNKKSIFPANINDKQIMECSRMLDTSEKYSKGYKTD
GAVTSPLTGNNTITTFIPISASDMQKFTILEYLYIMRVMANNVKKKNEGKNNGGVVMHINSPFKVINLPKC
371
Not Available
Not Available
07-12-2004
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Late protein which is a part of a large complex required for early virion morphogenesis. This complex participates in the formation of virosomes and the incorporation of virosomal contents into nascent immature virions (By similarity).
Not Available
Host cytoplasm . Virion . Note=Localizes in cytoplasmic virus factories and present in the virion core. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available