Reviewed
Homo Sapiens (Human) [TaxID: 9606]
A36R
Protein A36
Vaccinia Virus (strain Copenhagen) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Copenhagen) (VACV)
2219722 ;
Various pathway(s) in which protein is involved
Not Available
Not Available
MMLVPLITVTVVAGTILVCYILYICRKKIRTVYNDNKIIMTKLKKIKSSNSSKSSKSTDSESDWEDHCSAMEQNNDVDNISRNEILDDDSFAGSLIWDNE
SNVMAPSTEHIYDSVAGSTLLINNDRNEQTIYQNTTVVINETETVEVLNEDTKQNPNYSSNPFVNYNKTSICSKSNPFITELNNKFSENNPFRRAHSDDY
LNKQEQDHEHDDIESSVVSLV
SNVMAPSTEHIYDSVAGSTLLINNDRNEQTIYQNTTVVINETETVEVLNEDTKQNPNYSSNPFVNYNKTSICSKSNPFITELNNKFSENNPFRRAHSDDY
LNKQEQDHEHDDIESSVVSLV
221
Not Available
Not Available
07-12-2004
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Involved in the intracellular transport of virions to the host cell surface. Participates also in the formation of actin tails at the plasma membrane to allow efficient actin-based motility and thus cell to cell transmission of viral particles. Mechanistically, phosphorylation of Tyr-112 and 132 of A36 activates the host ARP2-ARP3 complex and leads to actin nucleation (By similarity).
Not Available
♦ Host membrane
♦ Single-pass membrane protein . Note=Found exclusively on the wrapped enveloped virion. Absent in the mature virion (MV) and extracellular enveloped virion (EV) (By similarity). .
♦ Single-pass membrane protein . Note=Found exclusively on the wrapped enveloped virion. Absent in the mature virion (MV) and extracellular enveloped virion (EV) (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available