viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
I2L[Gene ID: 3707604 ]
Protein I2
Vaccinia Virus (strain L-IVP) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain L-IVP) (VACV)
Various pathway(s) in which protein is involved
Not Available
MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLILLLLIYLYLKVVW
73
Not Available
Not Available
07-12-2004
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Late protein which probably plays a role in virus entry into the host cell.
Not Available
♦ Virion membrane
♦ Single-pass membrane protein . Note=Component of the membrane of the mature virion.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available