viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
MVA018L ACAM3000_MVA_018 C7L[Gene ID: 3707636 ]
Interferon antagonist C7 (Host range protein 2)
Vaccinia Virus (strain Ankara) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Ankara) (VACV)
Various pathway(s) in which protein is involved
Not Available
MGIQHEFDIIINGDIALRNLQLHKGDNYGCKLKIISNDYKKLKFRFIIRPDWSEIDEVKGLTVFANNYAVKVNKVDDTFYYVIYEAVIHLYNKKTEILIY
SDDENELFKHYYPYISLNMISKKYKVKEENYSSPYIEHPLIPYRDYESMD
150
Not Available
Not Available
07-12-2004
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Inhibits antiviral activity induced by type I interferons. Does not block signal transdution of IFN, but is important to counteract the host antiviral state induced by a pre-treatment with IFN (By similarity).
Not Available
Not Available
Not Available
Not Available
X-ray crystallography (1)
5CYW  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available