viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
A17L
Virion membrane protein A17 precursor (23 kDa late protein) [Cleaved into: Mature 21 kDa protein A17]
Vaccinia Virus (strain Copenhagen) (VACV)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Vaccinia Virus> Vaccinia Virus (strain Copenhagen) (VACV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSYLRYYNMLDDFSAGAGVLDKDLFTEEQQQSFMPKDGGMMQNDYGGMNDYLGIFKNNDVRTLLGLILFVLALYSPPLISILMIFISSFLLPLTSLVITY
CLVTQMYRGGNGNTVGMSIVCIVAAVIIMAINVFTNSQIFNIISYIILFILFFAYVMNIERQDYRRSINVTIPEQYTCNKPYTAGNKVDVDIPTFNSLNT
DDY
203
Not Available
Not Available
07-12-2004
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Envelope protein which participates in virus morphogenesis. Needed for an early step in viral crescent membrane formation by interacting with D13 scaffold protein. Its interaction with D13 scaffold protein leads to the formation of rigid, crescent-shaped membranes that assemble around the cytoplasmic virus factory. Membrane anchor for the protein A27. A17-A27 virus envelope protein might be involved in fusion or attachment, and can further associate to A26 (By similarity).
Not Available
♦ Virion membrane
♦ Multi-pass membrane protein . Note=The 23 kDa precursor is associated with immature virions (IV) and the final 21 kDa form is present in mature virions (MV). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available