viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
GH BHLF1 U48[Gene ID: 1487928 ]
Envelope glycoprotein H (gH)
Human Herpesvirus 6A (strain Uganda-1102) (HHV-6 Variant A) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Betaherpesvirus 6A> Human Herpesvirus 6A (strain Uganda-1102) (HHV-6 Variant A) (Human B Lymphotropic Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
MLLRLWVFVLLTPCYGWRPLNISNSSHCRNGNFENPIVRPGFITFNFYTKNDTRIYQVPKCLLGSDITYHLFDAINTTESLTNYEKRVTRFYEPPMNDIL
RLSPVPSVKQFNLDRSIQPQVVYSLNMYPSQGIYYVRVVEVRQMQYDNVSCKLPNSLKELIFPVQVRCAKITRYVGEDIYTHFFTPDFMILYIQNPAGDL
TMMYGNTTSINFKAPYKKSSFIFKQTLTDDLLLIVEKDVIDVQYRFISDATFVDETLNDVDEVEALLLKFNNLGIQTLLRGDCKKPNYAGIPQMMFLYGI
VHFSYSTKNTGPMPVLRVLKTHENLLSIDSFVNRCVNVSEGTLQYPKMKEFLKYEPSDYSYITKNKSISVSTLLTYLATAYESNVTISKYKWTDIANTLQ
NIYEKHMFFTNLTFSDRETLFMLAEIANIIPTDERMQRHMQLLIGNLCNPVEIVSWARMLTADRAPNLENIYSPCASPVRRDVTNSFLKTVLTYASLDRY
RSDMMEMLSVYRPPNMERVAAIQCLSPSEPAASLTLPNVTFVISPSYVIKGVSLTITTTIVATSIIITAIPLNSTCVSTNYKYAGQDLLVLRNISSQTCE
FCQSVVMEYDDIDGPLQYIYIKNIDELKTLTDPNNNLLVPNTRTHYLLLAKNGSVFEMSEVGIDIDQVSIILVIIYILIAIIALFGLYRLIRLC
694
Not Available
Not Available
09-11-2004
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Following initial binding to host receptor, membrane fusion is mediated by the fusion machinery composed of gB and the heterodimer gH/gL. May also be involved in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0019064  ;   GO:0020002  ;   GO:0044175  ;  
GO:0055036  
♦ Virion membrane
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Host endosome membrane
♦ Single-pass type I membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available