viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
U21[Gene ID: 3289479 ]
U21 glycoprotein
Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Betaherpesvirus 7> Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MWTILLFCVPVIYGELYPDFCPLAVVDFDVNATVDDLLLFDISLSKQCSDDKIRHSAVAAMTDNAFFFGNSETQIETDFGKYLAFNCYQVFSTLNHFLFK
NFKKTKGLMKRYDKLCLDVESYIHIQIICSPFKSFIRLRRMNETGISPRILETTFYLQNKRNSTWVAIKNYLGEDDPFTYRIWHTLTHAKNFLINSCEND
FNQLFFWQRKYLSLAKTFEATFKQGFNPMIEQRNEQRYRTNNIDCSFSKFRQNGVKVAVCKYTGWGVSGFGSLEVLQKIKSPFGEEWKRVGFNSTGAFTP
LYGSDVLWGLIFLRVEMTTYVCTCTNKNTGTQIQVTLPDVDLDLLDSEKTSSNVFVDMLCYTLIAILFLAFVTAVVLLGVSCLDGVQKVLTWPLQHIQKE
PVSEKIINLTNLMFGQEPLPKKESLKQQCL
430
Not Available
Not Available
01-03-2004
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Binds to MHC class I molecules in the endoplasmic reticulum and targets them from the Golgi directly to the lysosomes. Once in the lysosomes both proteins are degraded. In consequence, surface class I molecules are down-regulated and infected cells are masked for immune recognition by cytotoxic T lymphocytes (By similarity).
Not Available
♦ Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available