viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Paguma Larvata (Masked Palm Civet) [TaxID: 9675]
9b[Gene ID: 1489679 ]
Protein 9b (Accessory protein 9b) (ORF-9b)
Human SARS Coronavirus (SARS-CoV) (Severe Acute Respiratory Syndrome Coronavirus)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Nidovirales> Coronaviridae> Coronavirinae> Betacoronavirus> Severe Acute Respiratory Syndrome-related Coronavirus> Human SARS Coronavirus (SARS-CoV) (Severe Acute Respiratory Syndrome Coronavirus)
Various pathway(s) in which protein is involved
Not Available
MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK
98
Not Available
Not Available
23-04-2003
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
♦ Host cytoplasmic vesicle membrane
♦ Peripheral membrane protein . Host cytoplasm . Note=Binds non-covalently to intracellular lipid bilayers.
Not Available
Not Available
X-ray crystallography (1)
2CME  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available