Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Paguma Larvata (Masked Palm Civet) [TaxID: 9675]
3a
Protein 3a (Accessory protein 3a) (Protein U274) (Protein X1)
Human SARS Coronavirus (SARS-CoV) (Severe Acute Respiratory Syndrome Coronavirus)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Nidovirales> Coronaviridae> Coronavirinae> Betacoronavirus> Severe Acute Respiratory Syndrome-related Coronavirus> Human SARS Coronavirus (SARS-CoV) (Severe Acute Respiratory Syndrome Coronavirus)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAG
MEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDY
VVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL
MEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDY
VVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL
274
Not Available
Not Available
23-04-2003
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Forms homotetrameric potassium sensitive ion channels (viroporin) and may modulate virus release. Up-regulates expression of fibrinogen subunits FGA, FGB and FGG in host lung epithelial cells. Induces apoptosis in cell culture. Downregulates the type 1 interferon receptor by inducing serine phosphorylation within the IFN alpha-receptor subunit 1 (IFNAR1) degradation motif and increasing IFNAR1 ubiquitination.
Not Available
GO:0005216 ; GO:0005576 ; GO:0016021 ; GO:0019012 ; GO:0020002 ;
GO:0039502 ; GO:0039511 ; GO:0039707 ; GO:0044178 ; GO:0044385 ;
GO:0051259
GO:0039502 ; GO:0039511 ; GO:0039707 ; GO:0044178 ; GO:0044385 ;
GO:0051259
♦ Virion. Host Golgi apparatus membrane
♦ Multi-pass membrane protein. Host cell membrane
♦ Multi-pass membrane protein. Secreted. Host cytoplasm. Note=The cell surface expressed protein can undergo endocytosis. The protein is secreted in association with membranous structures.
♦ Multi-pass membrane protein. Host cell membrane
♦ Multi-pass membrane protein. Secreted. Host cytoplasm. Note=The cell surface expressed protein can undergo endocytosis. The protein is secreted in association with membranous structures.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available