viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Paguma Larvata (Masked Palm Civet) [TaxID: 9675]
M 5[Gene ID: 1489672 ]
Membrane protein (M protein) (E1 glycoprotein) (Matrix glycoprotein) (Membrane glycoprotein)
Human SARS Coronavirus (SARS-CoV) (Severe Acute Respiratory Syndrome Coronavirus)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Nidovirales> Coronaviridae> Coronavirinae> Betacoronavirus> Severe Acute Respiratory Syndrome-related Coronavirus> Human SARS Coronavirus (SARS-CoV) (Severe Acute Respiratory Syndrome Coronavirus)
Various pathway(s) in which protein is involved
Not Available
MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFR
LFARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRI
GNYKLNTDHAGSNDNIALLVQ
221
Not Available
Not Available
23-04-2003
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0019058  ;   GO:0039503  ;   GO:0039547  ;  
GO:0039660  ;   GO:0044178  ;   GO:0055036  
♦ Virion membrane
♦ Multi-pass membrane protein . Host Golgi apparatus membrane
♦ Multi-pass membrane protein . Note=Largely embedded in the lipid bilayer. .
Not Available
Not Available
X-ray crystallography (1)
3I6G  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available