viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
US11
RNA-binding protein (Vmw21)
Human Herpesvirus 1 (strain MP) (HHV-1) (Human Herpes Simplex Virus 1)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 1 (HHV-1) (Human Herpes Simplex Virus 1)> Human Herpesvirus 1 (strain MP) (HHV-1) (Human Herpes Simplex Virus 1)
Not Available
 
Various pathway(s) in which protein is involved
Not Available
Not Available
MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPP
REPREPRVPRASRDPRVPRDPRDPRQPRSPREPRSPREPRPPREPRTPRTTREPRTARGAV
161
Not Available
Not Available
01-12-2000
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the inhibition of host immune response. Participates in the inhibition of host autophagy by interacting with and inhibiting host PKR/EIF2AK2. This interaction also prevents the interferon-induced shut down of protein synthesis following viral infection. Downmodulates the host RLR signaling pathway via direct interaction with host DDX58 and IFIH1. May also participate in nuclear egress of viral particles through interactions with host NCL and regulation of the viral UL34 mRNA.
Not Available
GO:0003677  ;   GO:0003723  ;   GO:0030430  ;   GO:0039502  ;   GO:0039521  ;  
GO:0039540  ;   GO:0039554  ;   GO:0039580  ;   GO:0044196  
Host nucleus, host nucleolus . Host cytoplasm . Note=Following infection, it is released into the cell cytoplasm. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available