viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
GN KA7R U46[Gene ID: 1497048 ]
Envelope glycoprotein N
Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Herpesvirus 6B (HHV-6 Variant B) (Human B Lymphotropic Virus)> Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MSCKKGARQRLYVSLWLFYILVFAAATEMDFYSSECHSHTYEIVLNSFSSIWLLINLFLLLCSFAIFLKYWCYKTFASETVKGY
84
Not Available
Not Available
01-10-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0033644  ;   GO:0044177  ;   GO:0055036  
♦ Virion membrane
♦ Single-pass type I membrane protein . Host membrane
♦ Single-pass type I membrane protein . Host Golgi apparatus, host trans-Golgi network . Note=When coexpressed with gM, localizes in the host trans-Golgi network. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available