Reviewed
Homo Sapiens (Human) [TaxID: 9606]
U44[Gene ID: 3289502 ]
Tegument protein UL51 homolog
Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Betaherpesvirus 7> Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MGNCFVKKISSDIFNSNYQMLYSELSEQEDLLDFLETKYTDFGILKTDILNYERDSETFKTLLQVLPIYKKTKLRYNLIERCLNNCPPHVKDALIIEIMK
AKKILETLDVVFMKIMIGEFTICSDNVNQLLNKFSIDQTTLCDMEKINTLIDLDEENSKRLLTEIDPLLHQETGLYQALPNAVTDPPSEQRAATKKCYEG
FTK
AKKILETLDVVFMKIMIGEFTICSDNVNQLLNKFSIDQTTLCDMEKINTLIDLDEENSKRLLTEIDPLLHQETGLYQALPNAVTDPPSEQRAATKKCYEG
FTK
203
Not Available
Not Available
01-10-1996
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Plays several roles during the time course of infection, including egress of virus particles from the perinuclear space and secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes.
Not Available
Virion tegument . Host cytoplasm . Host Golgi apparatus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available