viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
U70 CH3R[Gene ID: 1497070 ]
Alkaline nuclease (EC 3.1.-.-)
Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Herpesvirus 6B (HHV-6 Variant B) (Human B Lymphotropic Virus)> Human Herpesvirus 6B (strain Z29) (HHV-6 Variant B) (Human B Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MDLNQISETLSAVAEEEPLTMFLLDKLYAIREKIKQVPFSIVRLCHVYCMLIKYNASNNNCILGRKLIEEMQQFLCGARVDGSEDVSMDMSELCKLYDYC
PLLCSALCRAPCVFVNKLFKIVERETRGQSENPLWHALRRYTVTATKLYDIYTTRNFLEHKGQQFFGEAVIYGAKHERVIRHLVAIFYVKREVKETLGLL
LDPSSGVFGASLDACFGISFNEDGFLMVKEKALIFEIKFRYKYLRDKEDHFVSELLKNPTEKSFSDFILSHPVPAIEFRERGKIPSSREYLMTYDFQYRP
QRKLRTCPTPAILTPHIKQLLCLNETQTSTVIVFDCKSHLSEQKLSVFQKAVFTVNVFVNPKHRYFFQSLLQQYVMTQFYINDHSNPEYIESTEVPSVHI
VTALFRRRTEEERSLHLVIDETEYIEEEIPLALIVTPVAPNPEFTCRVITDICNLWENNICKQTSLQVWAQSAVNQYLAACVRKPKTP
488
Not Available
Not Available
01-10-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in processing non linear or branched viral DNA intermediates in order to promote the production of mature packaged unit-length linear progeny viral DNA molecules. Exhibits endonuclease and exonuclease activities and accepts both double-stranded and single-stranded DNA as substrate. Exonuclease digestion of DNA is in the 5'-> 3' direction and the products are 5'-monophosphate nucleosides. Additionally, forms a recombinase with the major DNA-binding protein, which displays strand exchange activity.
3.1.-.-  
GO:0003677  ;   GO:0004519  ;   GO:0004527  ;   GO:0016032  ;   GO:0030430  ;  
GO:0042025  
Host nucleus . Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available