viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
TRM1 U40
Tripartite terminase subunit 1
Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Betaherpesvirus 7> Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
Not Available
MNSLQSLCVLCSRLSECALELECLRFCDPVTLIPDMTNFRKNGVVIIHLFKTLFAELCHQNFNCASPVTIYLQILLKAMYNQVLLLDASIHQFLLDNDKQ
KYFENIFQLNECKQHLKLDLALNNYLTFSVDISTINDIEKLLCKMNCIFGLISPLDGINACSQIIEFLTILCGVCVVMKPEVFSETTTCLKCYEELSLVP
NQGKSIRKRLAGKFCNHLTETHMVSNLEKNVDIIEKDLDFSTKQYGLVKEYMAKITNIFQQQLYSKPPHLQEAENTLINFDLFSKIPDTIYSLSEFTYWS
KISESVIQKASITLNQLNLCHSLYADLQNEISKFLYGETIQDVFNFNEENVTNDDKLYIGSRFISPCRLVDIITNVSIKNLEEDPVFTKLAEEDEIQTKI
KTLLNELENSAHETVPKKYVTHSMTQDHNLQQEIHIRKKAYYQKISESGYSKVMLCIKEQEALINKLMNINILGNHIFESLSKMMNAFANRQLQSLENFS
ADPFTYDDHLYIKNNLLSKKLPQELLPNLSQEMYRLLTGPLSNYHTASFPLSSNISMAYACDVADFLPHMKEDLAKCVEGTIYPENWMLCTYNKFFNFDG
LHNINDMQRQMWNFIRELVLSVALYNDVFGKQLSIVKFGEETETVEKILLTFDSGSPLLFKRGTTTTKFNDLYSLLYFDLKTQCDPVQISQTKQVSHIPA
PNLLDLCRQNENSIPECFYNF
721
Not Available
Not Available
01-10-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM2 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid. TRM1 carries an endonuclease activity that plays an important role for the cleavage of concatemeric viral DNA into unit length genomes.
Not Available
GO:0005524  ;   GO:0019073  ;   GO:0042025  ;   GO:0046872  
Host nucleus . Note=Found associated with the external surface of the viral capsid during assembly and DNA packaging, but seems absent in extracellular mature virions. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available