viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
NEC1 U37
Nuclear egress protein 1
Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Betaherpesvirus 7> Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
Not Available
MAIQSTRRLRRASSLLKKSKPYNKEKTNLSLSLSLKELHSVFKLFPEYELKFLNMMKLPITGKEPIKIPFDLSLHHQHTCLDLSPYANEQVSKSACVNCG
TTNIPTASDAMVAYMNQISNVMQNRLYYYGFQKKVELIRMSAKQPTLFQIFYILSSIASNFLPIMFENNEKLNMYVVFQTRTLHIPCECINQIMTVSSGY
TVLLDILHDSIVLHVLCKTIETSNIQIDINVLQRKIEEMDVPDEIGDKFEKLKHILPFI
259
Not Available
Not Available
01-10-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.
Not Available
GO:0016020  ;   GO:0044201  ;   GO:0046765  ;   GO:0046872  
Host nucleus inner membrane . Note=Remains attached to the nucleus inner membrane through interaction with NEC2. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available