viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
U71[Gene ID: 3289529 ]
Cytoplasmic envelopment protein 3
Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Betaherpesvirus 7> Human Herpesvirus 7 (strain JI) (HHV-7) (Human T Lymphotropic Virus)
Various pathway(s) in which protein is involved
Not Available
MGSKCCKTIHGGIFSKAEDTLVDYKGKYINLEKEFSALSDTESEEELQLEKPLLNKQDSSVSLTQKKLENQSK
73
Not Available
Not Available
23-01-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery.
Not Available
GO:0019033  ;   GO:0020002  ;   GO:0044178  ;   GO:0055036  
♦ Virion tegument . Virion membrane
♦ Lipid-anchor . Host cell membrane
♦ Lipid-anchor
♦ Cytoplasmic side . Host Golgi apparatus membrane
♦ Lipid-anchor
♦ Cytoplasmic side . Note=Virion membrane-associated tegument protein. Associates with host membrane lipids rafts. During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available