viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L1
Major capsid protein L1
Human Papillomavirus Type 62
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Alphapapillomavirus> Alphapapillomavirus 3> Human Papillomavirus Type 62
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MAMWRPGDGKVYLPPTPVSKVLSTDTYVTRTNLFYYGGSSRLLTVGHPYCTLQVGQGKRATIPKVSGYQYRVFRVKLPDPNKFTLPDATLYNPDTERMVW
ACRGIEVGRGQPLGVGTSGHPLYNRLDDTENTSLLAAANDDSRDNISVDYKQTQLLIVGCKPPIGEHWTKGTLCPNAAPAPTECPPLEFKNTTIQDGDMV
ETGYGAIDFKSLQESKSEVPLDICTSTCKYPDYLQMAAEPYGDCMFFCLRREQMFARHFFNRHGTMGEALPTDLYMKGTPGSDRQMPGSYIYAPTPSGSM
VSSDSQLFNKPYWLQRAQGHNNGICWFNELFVTVVDTTRSTNFTICTASTAAAEYKATNFREFLRHTEEFDLQFIFQLCKIQLTPEIMAYLHNMNKDLLD
DWNFGVLPPPSTSLDETYHYLQSRAITCQKGAASPSPKVDPYAQMTFWTVDLKDKLSTDLDQFPLGRKFLLQAGSRPRSVAVSRKRSAPTKQSPTSAKRK
RRK
503
Not Available
Not Available
27-09-2005
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Forms an icosahedral capsid with a T=7 symmetry and a 50 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with L2 proteins. Binds to heparan sulfate proteoglycans on cell surface of basal layer keratinocytes to provide initial virion attachment. This binding mediates a conformational change in the virus capsid that facilitates efficient infection. The virion enters the host cell via endocytosis. During virus trafficking, L1 protein dissociates from the viral DNA and the genomic DNA is released to the host nucleus. The virion assembly takes place within the cell nucleus. Encapsulates the genomic DNA together with protein L2.
Not Available
GO:0005198  ;   GO:0019062  ;   GO:0039620  ;   GO:0042025  ;   GO:0075509  
Virion . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available