Reviewed
Homo Sapiens (Human) [TaxID: 9606]
IVa2[Gene ID: 2715937 ]
Packaging protein 1 (Packaging protein IVa2)
Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus F> Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Various pathway(s) in which protein is involved
Not Available
METRGRRRAFSHQQDEPEENPGKRPTRSAPLYRHRNQPNANPATLERHYPCSTGRPPTGTVQPKPSQPPQPRSLLDRDAIDHITELWDRLYLLRQSLEKM
TMADGLKPLKHFRSLEELLSLGGERLLQDLVKENQHVRSMMNEVTPLLREDGSCISLNYQLQPVIGVIYGPTGCGKSQLLRNLLSTQLINPPPETVFFIA
PQVDMIPPSEIKAWEMQICEGNYAPGPEGTIIPQSGTLLPRFIKMAYDELTLEQNYDVSHPDNIFAKAASQGPIAIIMDECMENLGGHKGVSKFFHAFPS
KLHDKFPKCTGYTVLVVLHNMNPRRDLGGNIANLKIQAKMHLISPRMHPSQLNRFVNTFTKGLPLAISLLLKDIFQFHAQKPCYDWIIYNTTPEHDALQW
SYLHPRDGLMPMYLNIQAHLYRVLENIHKVLNDRDRWSRAYRKRNK
TMADGLKPLKHFRSLEELLSLGGERLLQDLVKENQHVRSMMNEVTPLLREDGSCISLNYQLQPVIGVIYGPTGCGKSQLLRNLLSTQLINPPPETVFFIA
PQVDMIPPSEIKAWEMQICEGNYAPGPEGTIIPQSGTLLPRFIKMAYDELTLEQNYDVSHPDNIFAKAASQGPIAIIMDECMENLGGHKGVSKFFHAFPS
KLHDKFPKCTGYTVLVVLHNMNPRRDLGGNIANLKIQAKMHLISPRMHPSQLNRFVNTFTKGLPLAISLLLKDIFQFHAQKPCYDWIIYNTTPEHDALQW
SYLHPRDGLMPMYLNIQAHLYRVLENIHKVLNDRDRWSRAYRKRNK
446
Not Available
Not Available
01-02-1996
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Component of the packaging machinery which encapsidates the viral DNA into preformed capsids and transcriptional activator of the viral major late promoter (MLP). Binds, along with packaging proteins 2 and 3, to the specific packaging sequence on the left end of viral genomic DNA and displays ATPase activity thereby providing the power stroke of the packaging machinery. The activity of packaging protein IVa2 is stimulated by protein 33K which acts as a terminase. May be the protein that pumps DNA into the capsid powered by ATP hydrolysis. Specifically binds to the 5'-CG-3' nucleotides of the repeats making up the packaging sequence. Component of the DEF-A and DEF-B transcription factors that bind downstream elements of the major late promoter (MLP), and stimulate transcription from the MLP after initiation of viral DNA replication. DEF-A is a heterodimer packaging proteins 1 and 2 and DEF-B is a homodimer of packaging protein 1.
Not Available
GO:0003677 ; GO:0005524 ; GO:0006351 ; GO:0006355 ; GO:0019012 ;
GO:0019073 ; GO:0044095 ; GO:0044196
GO:0019073 ; GO:0044095 ; GO:0044196
Virion . Host nucleus, host nucleoplasm . Host nucleus, host nucleolus . Note=Located at a unique vertex of the capsid. Present in about 6-8 copies per virion. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available