Reviewed
Chlorocebus Aethiops (Green Monkey) (Cercopithecus Aethiops) [TaxID: 9534]; Homo Sapiens (Human) [TaxID: 9606]; Rousettus Aegyptiacus (Egyptian Rousette) (Egyptian Fruit Bat) [TaxID: 9407]
VP30
Minor nucleoprotein VP30 (Transcription activator VP30)
Lake Victoria Marburgvirus (strain Popp-67) (MARV) (Marburg Virus (strain West Germany/Popp/1967))
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Marburgvirus> Marburg Marburgvirus> Lake Victoria Marburgvirus (strain Popp-67) (MARV) (Marburg Virus (strain West Germany/Popp/1967))
Various pathway(s) in which protein is involved
Not Available
Not Available
MQQPRGRSRTRNHQTASSIYHETQLPSKPHYTNHHPRARSMSSTRSSAESSPTNHIPRARPPPTFNLSKPPPPPKDMCRNMKIGLPCTDPTCNRDHDLDN
LTNRELLLLMARKMLPNTDKTFRSLQDCGSPSLSKGLSKDKQEQTKDVLTLENLGHILNYLHRSDIGKLDETSLRAALSLTCAGIRKTNRSLINTMTELH
INHENLPQDQNGVIKQTYTGIHLDKGGQFEAALWQGWDKRSISLFVQAALYVMNNIPCESSTSVQASYDHFILPQSQSKGQ
LTNRELLLLMARKMLPNTDKTFRSLQDCGSPSLSKGLSKDKQEQTKDVLTLENLGHILNYLHRSDIGKLDETSLRAALSLTCAGIRKTNRSLINTMTELH
INHENLPQDQNGVIKQTYTGIHLDKGGQFEAALWQGWDKRSISLFVQAALYVMNNIPCESSTSVQASYDHFILPQSQSKGQ
281
Not Available
Not Available
01-02-1995
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Acts as a transcription anti-termination factor immediately after transcription initiation, but does not affect transcription elongation. This function has been found to be dependent on the formation of an RNA secondary structure at the transcription start site of the first gene (By similarity).
Not Available
Virion. Host cytoplasm . Note=Tightly bound in the nucleocapsid.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available