viHumans
Reviewed
Chlorocebus Aethiops (Green Monkey) (Cercopithecus Aethiops) [TaxID: 9534]; Homo Sapiens (Human) [TaxID: 9606]; Rousettus Aegyptiacus (Egyptian Rousette) (Egyptian Fruit Bat) [TaxID: 9407]
VP24
Membrane-associated protein VP24
Lake Victoria Marburgvirus (strain Popp-67) (MARV) (Marburg Virus (strain West Germany/Popp/1967))
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Marburgvirus> Marburg Marburgvirus> Lake Victoria Marburgvirus (strain Popp-67) (MARV) (Marburg Virus (strain West Germany/Popp/1967))
Various pathway(s) in which protein is involved
Not Available
Not Available
MAELSTRYNLPANVTEKSINLDLNSTARWIKEPSVGGWTVKWGNFVFHIPNTGMALLHHLKSNFVVPEWQQTRNLFSHLFKNPKSTIIEPFLALRILLGV
ALKDQELQQSLIPGFRSIVHMLSEWLLLEVTSAIHISPNLLGIYLTSDMFKILMAGVKNFFNKMFTLHVVNDHGKPSSIEIKLTGQQIIITRVNMGFLVE
VRRIDIEPCCGETVLSESVVFGLVAEAVLREHSQMEKGQPLDLTQYMNSKIAI
253
Not Available
Not Available
01-02-1995
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
May act as a minor matrix protein that plays a role in assembly of viral nucleocapsid and virion budding.
Not Available
GO:0016032  ;   GO:0020002  ;   GO:0033645  ;   GO:0039660  ;   GO:0055036  
♦ Virion membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Host endomembrane system
♦ Peripheral membrane protein . Note=In virion, localizes on the intravirional side of the membrane. In the host cell, it is found associated with virus-induced membrane proliferation foci and to the plasma membrane where budding takes place (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available