viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L3
Hexon protein (CP-H) (Protein II) (Fragment)
Human Adenovirus E Serotype 4 (HAdV-4) (Human Adenovirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus E> Human Adenovirus E Serotype 4 (HAdV-4) (Human Adenovirus 4)
Various pathway(s) in which protein is involved
Not Available
Not Available
FDIRGVLDRGSFKPYSGTAYNSLAPKGAPNTCQWKDSDSKMHTFGVAAMPGVTGKKIEADGLPIGIDSTSGTDTVIYADKTFQPEPQVGNDSWVDTNGAE
EKYGGRALKDTTKMKPCYGSFAKPTNKEGGQANLKDSEPAATTPNYDIDLAFFDSKTIVANYDPDIVMYTENVDLQTPDTHIVYKPGTEDTSSESNLGQQ
AMPNRPNYIGFRDNFIGLMYYNSTGNMGVLAGQASQLNAVVDLQDRNTELSYQLLLDSLGDRTRYFSMWNQAVDSYDPDVRIIENHGVEDELPNYCFPLN
GVGLTDTYQGVKVKTDAGSEKWDKDDTTVSNANEIHVGNPFAMEINIQANLWRNFLYANVGLYLPDKYKYTPANITLPTNTNTYEYMNGRVVAPSLVDAY
INIGARWSLDPMDNVNPFNHHRNAGLPYRSMLLGNGRYVPFHIQVPQ
447
Not Available
Not Available
01-06-1994
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus (By similarity).
Not Available
GO:0039623  ;   GO:0042025  ;   GO:0046718  ;   GO:0075521  
Virion . Host nucleus . Note=Forms the capsid icosahedric shell. Present in 720 copies per virion, assembled in 240 trimers (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available