viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E2
Regulatory protein E2
Human Papillomavirus Type 27
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Alphapapillomavirus> Alphapapillomavirus 4> Human Papillomavirus Type 27
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
METLANRLDACQETLLELYEKDSNKLEDQIKHWAQVRLENVMLFKARECGMTRVGCTTVPALTVSKAKACQAIEVQLALQTLMQSAYSTEAWTLRDTCLE
MWDAPPKKCWKKKGLSVLVKFDGSSDRDMIYTGWHHIYVQDANDDTWHKVPGKVDELGLYYEHDGVRVNYVDFGTESLTYGVTGTWEVHVAGRVIHHTSA
SVSSTQATASDDEPLSPIRLAVSPVPAPASAASARTGTAPPTNLLCTAPAPPSPPAKRQRVIVGQQHLRPDSTRTVGEGQVECYDKRSISNTNSTAPRWD
HGDTDTVPVIHLRGDANCLKCFRYRVQKHKDKLYDRVSSTWHWAGGKCDKTAFVTVWYTSVEQRKEFLTRVNIPKGVIALPGYMSAFV
388
Not Available
Not Available
01-06-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the initiation of viral DNA replication. A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is removed from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex.
Not Available
GO:0003677  ;   GO:0003700  ;   GO:0006260  ;   GO:0006275  ;   GO:0006351  ;  
GO:0016032  ;   GO:0042025  
Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available