viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L2
Core-capsid bridging protein (Core protein V)
Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus A> Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Various pathway(s) in which protein is involved
Not Available
Not Available
MPSMTKRKFKEELLQALAPEIYGPSDNLTKRDIKHVKKREKKEEEVAAASADGVEFVRSFAPRRRVQWKGRQVKRILRPGTTVVFSPGERTIMRPLKREY
DEVYADDDILEQAAQQTGEFAYGKKGRYGDKIAIPLDEGNPTPSLKAVTLQQVLPVLGPSEEKRGIKREAMDELQPTMQLMVPKRQKLEDVLEHMKVDPS
VQPDVKVRPIKKVAPGLGVQTVDIQIPVQTALGETMEIQTSPIKTTVNASVQTDPWYPPVLSTKKKRHYRQTSSLLPDYVLHPSIVPTPGYRGTTFQRRA
TAPSRRRGPSRRRRRRKATLAPAAVRRVVQRGRTLILPSVRYHPSIL
347
Not Available
Not Available
01-06-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Associates loosely with the viral DNA to form an outer shell around the nucleoprotein-DNA complex and links it with the capsid by binding the endosome lysis protein. Dissociates from the viral genome during entry. Might be involved in nuclear capsid assembly of the viral particles through its association with NPM1/nucleophosmin.
Not Available
Virion . Host nucleus, host nucleolus . Note=Located inside the capsid (core). Present in 157 copies per virion. Localizes in the nucleoli during infection, then translocates from the nucleoli to the nucleoplasm as the infection progresses and is finally incorporated into the viral particles. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available