viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Macaca Fascicularis (Crab-eating Macaque) (Cynomolgus Monkey) [TaxID: 9541]; Macaca Leonina (Northern Pig-tailed Macaque) (Macaca Nemestrina Leonina) [TaxID: 90387]; Macaca Mulatta (Rhesus Macaque) [TaxID: 9544]; Macaca Nemestrina (Pig-tailed Macaque) [TaxID: 9545]
GJ
Envelope glycoprotein J
Cercopithecine Herpesvirus 1 (CeHV-1) (Simian Herpes B Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Cercopithecine Herpesvirus 1 (CeHV-1) (Simian Herpes B Virus)
Various pathway(s) in which protein is involved
Not Available
Not Available
MRSLLFVVGAWVAAAVTHLTPNAALATGTTPTVGANSTADPGTGANGTTVPAAGTPANSTTAAETPAPFPPVDFALPVVIGGLCALTLAAMGAGALLHRC
CRRAAARRRQRAAYVYA
117
Not Available
Not Available
01-06-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Inhibits host cell apoptosis. Induces an increase in reactive oxygen species (ROS) in the host cell (By similarity).
Not Available
GO:0016021  ;   GO:0019050  ;   GO:0044167  ;   GO:0044175  ;   GO:0044178  
♦ Host Golgi apparatus membrane
♦ Single-pass type I membrane protein . Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein . Host endosome membrane
♦ Single-pass type I membrane protein . Note=Localizes to the endoplasmic reticulum, trans-Golgi network, and early endosomes. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available