Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Macaca Fascicularis (Crab-eating Macaque) (Cynomolgus Monkey) [TaxID: 9541]; Macaca Leonina (Northern Pig-tailed Macaque) (Macaca Nemestrina Leonina) [TaxID: 90387]; Macaca Mulatta (Rhesus Macaque) [TaxID: 9544]; Macaca Nemestrina (Pig-tailed Macaque) [TaxID: 9545]
GI
Envelope glycoprotein I (Fragment)
Cercopithecine Herpesvirus 1 (CeHV-1) (Simian Herpes B Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Cercopithecine Herpesvirus 1 (CeHV-1) (Simian Herpes B Virus)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGRLLGFLLALGPWALVAGVVIRGPTISLVSDSLLAAGAVGANGSFLEDLEVPGELHFLGPQVPHVTYYDGSVELLHYPPDARCPRAVLVEEMTACPRRN
AVAFTLCRS
AVAFTLCRS
109
Not Available
Not Available
01-06-1994
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system. Together with US9, the heterodimer gE/gI is involved in the sorting and transport of viral structural components toward axon tips.
Not Available
♦ Virion membrane
♦ Single-pass membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Host cell junction . Host Golgi apparatus membrane
♦ Single-pass type I membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN). The heterodimer gE/gI then redistribute to cell junctions to promote cell-cell spread later in the infection (By similarity). .
♦ Single-pass membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Host cell junction . Host Golgi apparatus membrane
♦ Single-pass type I membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN). The heterodimer gE/gI then redistribute to cell junctions to promote cell-cell spread later in the infection (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available