♦Structural polyprotein (p130) [Cleaved into: Capsid protein (EC 3.4.21.90) (Coat protein) (C)
♦ Precursor of protein E3/E2 (p62) (pE2)
♦ Assembly protein E3
♦ Spike glycoprotein E2 (E2 envelope glycoprotein)
♦ 6K protein
♦ Spike glycoprotein E1 (E1 envelope glycoprotein)]

NC_001449.1 ;  L04653.1 

MFPFQPMYPMQPMPYRNPFAAPRRPWFPRTDPFLAMQVQELTRSMANLTFKQRRGAPPEGPPAKKSKREAPQKQRGGQRKKKKNEGKKKAKTGPPNLKTQ
NGNKKKTNKKPGKRQRMVMKLESDKTFPIMLEGKINGYACVVGGKLFRPMHVEGKIDNDVLAALKTKKASKYDLEYADVPQNMRADTFKYTHEKPQGYYS
WHHGAVQYENGRFTVPRGVGARGDSGRPILDNQGRVVAIVLGGVNEGSRTALSVVMWNEKGVTVKYTPENCEQWSLVTTMCLLANVTFPCAQPPICYDRK
PAETLAMLSANVDNPGYDELLKAAVTCPGRKRRSTEELFKEYKLTRPYMARCVRCAVGSCHSPIAIEAVKSDGHDGYVRLQTSSQYGLDPSGNLKSRTMR
YNMYGTIEEIPLHQVSLHTSRPCHIVDGHGYFLLARCPAGDSITMEFKKDSVTHSCSVPYEVKFNPVGRELYTHPPEHGAEQACQVYAHDAQNRGAYVEM
HLPGSEVDSSLVSLSSGLVSVTPPAGTSALVECECSGTTISKTINKTKQFSQCTKKEQCRAYRLQNDKWVYNSDKLPKAAGATLKGKLHVPFLLADGKCT
VPLAPEPMITFGFRSVSLKLHPKYPTYLTTRELADEPHYTHELISEPSVRNFSVTAKGWEFVWGNHPPKRFWAQETAPGNPHGLPHEVIVHYYHRYPMST
ITGLSICAAIVAVSIAASTWLLCRSRASCLTPYRLTPNAKMPLCLAVLCCARSARAETTWESLDHLWNNNQQMFWTQLLIPLAALIVVTRLLKCMCCVVP
FLVVAGAAGAGAYEHATTMPNQAGISYNTIVNRAGYAPLPISITPTKIKLIPTVNLEYVTCHYKTGMDSPTIKCCGSQECTPTYRPDEQCKVFAGVYPFM
WGGAYCFCDTENTQISKAYVMKSEDCLADHAAAYKAHTASVQALLNITVGEHSTVTTVYVNGETPVNFNGVKLTAGPLSTAWTPFDRKIVQYAGEIYNYD
FPEYGAGQPGAFGDIQLRTVSSSDLYANTNLVLQRPKAGAIHVPYTQAPSGFEQWKKDKAPSLKFTAPFGCEIYTNPIRAENCAVGSIPLAFDIPDALFT
RVSETPTLSAAECTLNECVYSSDFGGIATVKYSASKSGKCAVHVPSGTATLKEASVELAEQGSVTIHFSTANIHPEFRLQICTSFVTCKGDCHPPKDHIV
THPQYHAQTFTAAVSKTAWTWLTSLLGGSAVIIIIGLVLATLVAMYVLTNQKHN

♦Capsid protein: Possesses a protease activity that results in its autocatalytic cleavage from the nascent structural protein. Following its self-cleavage, the capsid protein transiently associates with ribosomes, and within several minutes the protein binds to viral RNA and rapidly assembles into icosahedric core particles. The resulting nucleocapsid eventually associates with the cytoplasmic domain of the spike glycoprotein E2 at the cell membrane, leading to budding and formation of mature virions. In case of infection, new virions attach to target cells and after clathrin-mediated endocytosis their membrane fuses with the host endosomal membrane. This leads to the release of the nucleocapsid into the cytoplasm, followed by an uncoating event necessary for the genomic RNA to become accessible. The uncoating might be triggered by the interaction of capsid proteins with ribosomes. Binding of ribosomes would release the genomic RNA since the same region is genomic RNA-binding and ribosome-binding.
♦ Assembly protein E3: Provides the signal sequence for the translocation of the precursor of protein E3/E2 to the host endoplasmic reticulum. Mediates pH protection of spike glycoprotein E1 during the transport via the secretory pathway.
♦ Spike glycoprotein E2: Plays a role in viral attachment to target host cell, by binding to the cell receptor. Synthesized as a p62 precursor which is processed by furin at the cell membrane just before virion budding, giving rise to E2-E1 heterodimer. The p62-E1 heterodimer is stable, whereas E2-E1 is unstable and dissociate at low pH. p62 is processed at the last step, presumably to avoid E1 fusion activation before its final export to cell surface. E2 C-terminus contains a transitory transmembrane that would be disrupted by palmitoylation, resulting in reorientation of the C-terminal tail from lumenal to cytoplasmic side. This step is critical since E2 C-terminus is involved in budding by interacting with capsid proteins. This release of E2 C-terminus in cytoplasm occurs lately in protein export, and precludes premature assembly of particles at the endoplasmic reticulum membrane.
♦ 6K protein: Constitutive membrane protein involved in virus glycoprotein processing, cell permeabilization, and the budding of viral particles. Disrupts the calcium homeostasis of the cell, probably at the endoplasmic reticulum level. This leads to cytoplasmic calcium elevation. Because of its lipophilic properties, the 6K protein is postulated to influence the selection of lipids that interact with the transmembrane domains of the glycoproteins, which, in turn, affects the deformability of the bilayer required for the extreme curvature that occurs as budding proceeds. Present in low amount in virions, about 3% compared to viral glycoproteins.
♦ Spike glycoprotein E1: Class II viral fusion protein. Fusion activity is inactive as long as E1 is bound to E2 in mature virion. After virus attachment to target cell and endocytosis, acidification of the endosome would induce dissociation of E1/E2 heterodimer and concomitant trimerization of the E1 subunits. This E1 trimer is fusion active, and promotes release of viral nucleocapsid in cytoplasm after endosome and viral membrane fusion. Efficient fusion requires the presence of cholesterol and sphingolipid in the target membrane. Fusion is optimal at levels of about 1 molecule of cholesterol per 2 molecules of phospholipids, and is specific for sterols containing a 3-beta-hydroxyl group.

♦ Capsid protein: Virion . Host cytoplasm . Host cell membrane .
♦ Spike glycoprotein E2: Virion membrane JUX5
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein JUX5.
♦ 6K protein: Host cell membrane
♦ Multi-pass membrane protein . Virion membrane
♦ Multi-pass membrane protein .
♦ Spike glycoprotein E1: Virion membrane JUX5
♦ Single-pass type I membrane protein . Host cell membrane , JUX5
♦ Single-pass type I membrane protein .

DOMAIN 125 274 Peptidase S3.

♦ACT_SITE 151 151 Charge relay system.
♦ ACT_SITE 173 173 Charge relay system.
♦ ACT_SITE 225 225 Charge relay system.