viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
GB U39
Envelope glycoprotein B (gB)
Human Herpesvirus 6A (strain GS) (HHV-6 Variant A) (Human B Lymphotropic Virus)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Roseolovirus> Human Betaherpesvirus 6A> Human Herpesvirus 6A (strain GS) (HHV-6 Variant A) (Human B Lymphotropic Virus)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MSKMVVLFLAVFLMNSVLMIYCDPDHYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKKELTFQSSYR
DVGVVYFLDRTVMGLAMPVYEANLVNSHAQCYSAVAMKRPDGTVFSAFHEDNNKNNTLNLFPLNFKSITNKRFITTKEPYFARGPLWLYSTSTSLNCIVT
EATAKAKYPFSYFALTTGEIVEGSPFFNGSNGKHFAEPLEKLTILENYTMIEDLMNGMNGATTLVRKIAFLEKADTLFSWEIKEENESVCMLKHWTTVTH
GLRAETDETYHFISKELTAAFVAPKESLNLTDPKQTCIKDEFEKIINEVYMSDYNDTYSMNGSYQIFKTTGDLILIWQPLVQKSLMFLEQGSEKIRRRRD
VVDVKSRHDILYVQLQYLYDTLKDYINDALGNLAESWCLDQKRTITMLHELSKISPSSIVSEVYGRPISAQLHGDVLAISKCIEVNQSSVQLHKSMRVVD
AKGVRSETMCYNRPLVTFSFVNSTPEVVPGQLGLDNEILLGDHRTEECEIPSTKIFLSGNHAHVYTDYTHTNSTPIEDIEVLDAFIRLKIDPLENADFKV
LDLYSPDELSRANVFDLENILREYNSYKSALYTIEAKIATNTPSYVNGINSFLQGLGAIGTGLGSVISVTAGALGDIVGGVVSFLKNPFGGGLMLILAIV
VVVIIIVVFVRQRHVLSKPIDMMFPYATNPVTTVSSVTGTTVVKTPSVKDVDGGTSVAVSEKEEGMADVSGQVSDDEYSQEAALKMLKAIKSLDESYRRK
PSSSESHASKPSLIDRIRYRGYKSVNVEEA
830
Not Available
Not Available
01-06-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0019062  ;   GO:0020002  ;   GO:0044175  ;  
GO:0044178  ;   GO:0046718  ;   GO:0055036  
♦ Virion membrane
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Host endosome membrane
♦ Single-pass type I membrane protein . Host Golgi apparatus membrane
♦ Single-pass type I membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN). .
Not Available
MOTIF 822 825 Internalization motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available