Reviewed
Homo Sapiens (Human) [TaxID: 9606]
PX[Gene ID: 1460868 ]
Late L2 mu core protein (11 kDa core protein) (Protein X) (pX) (pMu)
Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus A> Human Adenovirus A Serotype 12 (HAdV-12) (Human Adenovirus 12)
Various pathway(s) in which protein is involved
Not Available
Not Available
MALTCRMRIPIPGYRGRPRRRKGLTGNGRFRRRSMRRRMKGGVLPFLIPLIAAAIGAVPGIASVALQASRKN
72
Not Available
Not Available
23-01-2007
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
The role of the precursor might be to condense the viral prochromatin for encapsidation by virtue of the two basic domains.
Not Available
Virion .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available