viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L5
Fiber protein (SPIKE) (Protein IV)
Human Adenovirus B Serotype 11 (strain Slobiski) (HAdV-11) (Human Adenovirus 11P (strain Slobiski))
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus B> Human Adenovirus B2> Human Adenovirus 11> Human Adenovirus B Serotype 11 (strain Slobiski) (HAdV-11) (Human Adenovirus 11P (strain Slobiski))
Various pathway(s) in which protein is involved
Not Available
Not Available
MTKRVRLSDSFNPVYPYEDESTSQHPFINPGFISPNGFTQSPNGVLTLKCLTPLTTTGGSLQLKVGGGLTVDDTNGFLKENISATTPLVKTGHSIGLPLG
AGLGTNENKLCIKLGQGLTFNSNNICIDDNINTLWTGVNPTEANCQIMNSSESNDCKLILTLVKTGALVTAFVYVIGVSNNFNMLTTHRNINFTAELFFD
STGNLLTRLSSLKTPLNHKSGQNMATGAITNAKGFMPSTTAYPFNDNSREKENYIYGTCYYTASDRTAFPIDISVMLNRRAINDETSYCIRITWSWNTGD
APEVQTSATTLVTSPFTFYYIREDD
325
Not Available
Not Available
01-06-1994
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Forms spikes that protrude from each vertex of the icosahedral capsid. Interacts with host receptor CD46 to provide virion initial attachment to target cell. Fiber proteins are shed during virus entry, when virus is still at the cell surface.
Not Available
GO:0007155  ;   GO:0019028  ;   GO:0042025  ;   GO:0046718  ;   GO:0098671  
Virion . Host nucleus . Note=Anchored to the pentons, protrudes from the virion surface. .
Not Available
Not Available
X-ray crystallography (2)
2O39  3EXV  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available