viHumans
Reviewed
Chlorocebus Aethiops (Green Monkey) (Cercopithecus Aethiops) [TaxID: 9534]; Homo Sapiens (Human) [TaxID: 9606]; Rousettus Aegyptiacus (Egyptian Rousette) (Egyptian Fruit Bat) [TaxID: 9407]
VP30[Gene ID: 920942 ]
Minor nucleoprotein VP30 (Transcription activator VP30)
Lake Victoria Marburgvirus (strain Musoke-80) (MARV) (Marburg Virus (strain Kenya/Musoke/1980))
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Marburgvirus> Marburg Marburgvirus> Lake Victoria Marburgvirus (strain Musoke-80) (MARV) (Marburg Virus (strain Kenya/Musoke/1980))
Various pathway(s) in which protein is involved
Not Available
MQQPRGRSRTRNHQVTPTIYHETQLPSKPHYTNYHPRARSMSSTRSSAESSPTNHIPRARPPSTFNLSKPPPPPKDMCRNMKIGLPCADPTCNRDHDLDN
LTNRELLLLMARKMLPNTDKTFRSPQDCGSPSLSKGLSKDKQEQTKDVLTLENLGHILSYLHRSEIGKLDETSLRAALSLTCAGIRKTNRSLINTMTELH
MNHENLPQDQNGVIKQTYTGIHLDKGGQFEAALWQGWDKRSISLFVQAALYVMNNIPCESSISVQASYDHFILPQSQGKGQ
281
Not Available
Not Available
15-01-2008
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Acts as a transcription anti-termination factor immediately after transcription initiation, but does not affect transcription elongation. This function has been found to be dependent on the formation of an RNA secondary structure at the transcription start site of the first gene (By similarity).
Not Available
GO:0006351  ;   GO:0019013  ;   GO:0030430  ;   GO:0046872  
Virion. Host cytoplasm . Note=Tightly bound in the nucleocapsid.
Not Available
Not Available
X-ray crystallography (1)
5T3W  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available