viHumans
Reviewed
Chlorocebus Aethiops (Green Monkey) (Cercopithecus Aethiops) [TaxID: 9534]; Homo Sapiens (Human) [TaxID: 9606]; Rousettus Aegyptiacus (Egyptian Rousette) (Egyptian Fruit Bat) [TaxID: 9407]
VP24[Gene ID: 920943 ]
Membrane-associated protein VP24
Lake Victoria Marburgvirus (strain Musoke-80) (MARV) (Marburg Virus (strain Kenya/Musoke/1980))
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Filoviridae> Marburgvirus> Marburg Marburgvirus> Lake Victoria Marburgvirus (strain Musoke-80) (MARV) (Marburg Virus (strain Kenya/Musoke/1980))
Various pathway(s) in which protein is involved
Not Available
MAELSTRYNLPANVTENSINLDLNSTARWIKEPSVGGWTVKWGNFVFHIPNTGMTLLHHLKSNFVVPEWQQTRNLFSHLFKNPKSTIIEPFLALRILLGV
ALKDQELQQSLIPGFRSIVHMLSEWLLLEVTSAIHISPNLLGIYLTSDMFKILMAGVKNFFNKMFTLHVVNDHGKPSSIEIKLTGQQIIITRVNMGFLVE
VRRIDIEPCCGETVLSESVVFGLVAEAVLREHSQMEKGQPLNLTQYMNSKIAI
253
Not Available
Not Available
01-02-1996
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
May act as a minor matrix protein that plays a role in assembly of viral nucleocapsid and virion budding.
Not Available
GO:0016032  ;   GO:0019013  ;   GO:0020002  ;   GO:0033645  ;   GO:0039660  ;  
GO:0055036  
♦ Virion membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Host endomembrane system
♦ Peripheral membrane protein . Note=In virion, localizes on the intravirional side of the membrane. In the host cell, it is found associated with virus-induced membrane proliferation foci and to the plasma membrane where budding takes place.
Not Available
Not Available
X-ray crystallography (1)
4OR8  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available