viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
A41L A46L[Gene ID: 1486527 ]
Protein A41
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MYSLVFVILMCIPFSFQTVYDDKSVCDSDNKEYMGIEVYVEATLDEPLRQTTCESEIHKYGASVSNGGLNISVDLLNCFLNFHTVGVYTNRDTVYAKFTS
LDPWTMEPINSMTYDDLVKLTEECIVDIYLKCEVDKTKDFIKTNGNRLKPRDFKTVPPNVGSIIELQSDYCVNDVTAYVKIYDECGNIKQHSIPTLRDYF
TTTNGQPRKILKKKFDNC
218
Not Available
Not Available
01-02-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
May interact with several cellular chemokines to interfere with chemokine-glycosaminoglycan (GAG) interactions at the cell surface to alter chemotaxis of nearby responsive cells.
Not Available
Secreted .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available