viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
A33R A36R[Gene ID: 1486514 ]
Protein A33
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGICIRISMVISLLSMITMSAFLIVRLNQCMSANEAAITDATAVAAALSTHRKVASSTTQYKHQESCN
GLYYQGSCYIFHSDYQLFSDAKANCATESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTTDYQDSDVSQEVRKYFCVKTMN
184
Not Available
Not Available
01-02-1994
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Coordinates the incorporation of A36 into intracellular enveloped virion (IEV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles (By similarity).
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0033644  ;   GO:0055036  
♦ Virion membrane
♦ Single-pass type II membrane protein . Host membrane
♦ Single-pass type II membrane protein . Note=Component of the enveloped virion (EV) membrane.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available