viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
A14L A15L[Gene ID: 1486489 ]
Virion membrane protein A14
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MDMMLMIGNYFSGVLIAGIILLILSCIFAFIDFSKSTSPTRTWKVLSIMSFILGIIITVGMLIYSMWGKHCAPHRVSGVIHTNHSDISVN
90
Not Available
Not Available
01-02-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Envelope protein which is a major component of the mature virion (MV) membrane. Essential for membrane biogenesis. Is required, together with A17, to form bona fide crescents, which can progress to form the immature virion (IV) membrane. A14 and A17 form a lattice that is stabilized by disulfide bonds and serves as an anchor within the viral membrane to which several other proteins important in virion structure and morphogenesis attach (By similarity).
Not Available
♦ Virion membrane
♦ Multi-pass membrane protein . Note=Component of the mature virion (MV) membrane. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available