viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
SPI-3 C2L[Gene ID: 1486579 ]
Protein K2 (Serine proteinase inhibitor 3)
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MIVLLILSLACTAFTYRLQGFTNAGIVAYKNIQDGNEDDNIVFSPFGYSFSMFMSLLPASGNTKVELLKTMDLRKIDLGPAFTELISGLAKPKTSKYTYT
DLTYQSFVDNTVCIKPSYYQQYHRFGLYRLNFRRDAVNKINSIVERRSGMSNVVDSTMLDNNTLWAIINTIYFKGTWQYPFDITKTHNTSFTNKYGTKTV
PMMSVVTKLQGNTITIDDEEYDMVRLQYKDANISMYLAIGDNMTHFTDSIMAAKLDYWSSQLGNKVYNLKLPRFSIENKRDIKSIAEMMAPSMFNPDNAS
FKHMTRDPLYIYKMFQNAKIDVNEQGTVAEASTIMVATVRSSPEELEFNTPFVFIIRHDITGFILFMGKVESP
373
Not Available
Not Available
01-02-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Prevents cell to cell fusion via its interaction with A56 protein. The A56-K2 complex associates with components of the entry fusion complex (EFC) presumably to avoid superinfection and syncytium formation (By similarity).
Not Available
GO:0004867  ;   GO:0005615  ;   GO:0020002  ;   GO:0055036  
♦ Virion membrane
♦ Peripheral membrane protein . Host cell membrane
♦ Peripheral membrane protein
♦ Extracellular side . Note=Component of extracellular enveloped virus (EEV) but not intracellular mature virus (IMV). Anchored to the surface of the outermost membrane of EEV via its interaction with A56 protein (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available