Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E8R[Gene ID: 1486414 ]
Protein E8
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MAAVVPRFDDVYKNAQRRILDQETFFSRGLGRPLMKNTYLFDNYAYGWIPETAIWSSRYANLDASDYYPISLGLLKKFKFLMSLYKGPIPVYEEKVNTEF
IANGSFSGRYVSYLRKFSALPTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYKPLFSRLKENYIFTGPVPIGI
KDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLLFYVPGYSITTKITPAVEYLMDKLKLTKNDVQLL
IANGSFSGRYVSYLRKFSALPTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYKPLFSRLKENYIFTGPVPIGI
KDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLLFYVPGYSITTKITPAVEYLMDKLKLTKNDVQLL
273
Not Available
Not Available
01-02-1994
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Early protein packaged into virion cores. May play a role in the biogenesis of the viral factories by recruiting and wrapping these DNA replication sites in endoplasmic reticulum derived membranes. Later in infection, phosphorylation of E8R by the late viral kinase F10L might decrease E8R DNA-binding ability and trigger ER membranes disassembly. Binds DNA in vitro (By similarity).
Not Available
♦ Virion . Host endoplasmic reticulum membrane
♦ Multi-pass membrane protein . Host cytoplasm. Note=Localizes to the inside membrane of cytoplasmic virus factories. Component of the core of mature virions (MV) (By similarity). .
♦ Multi-pass membrane protein . Host cytoplasm. Note=Localizes to the inside membrane of cytoplasmic virus factories. Component of the core of mature virions (MV) (By similarity). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available