Reviewed
Homo Sapiens (Human) [TaxID: 9606]
A27L A30L[Gene ID: 1486508 ]
14 kDa fusion protein
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKI
DVQTGRRPYE
DVQTGRRPYE
110
Not Available
Not Available
01-02-1994
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity).
Not Available
Virion. Note=Located to the mature virion membrane via interaction with protein A17. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available