viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
TMK A48R J2R[Gene ID: 1486448 ]
Thymidylate kinase (EC 2.7.4.9) (dTMP kinase)
Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Viruses> DsDNA Viruses> No RNA Stage> Poxviridae> Chordopoxvirinae> Orthopoxvirus> Variola Virus> Variola Virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox Virus)
Various pathway(s) in which protein is involved
Not Available
MSRGALIVFEGLDKSGKTTQCMNIMESIPTNTIKYLNFPQRSTVTGKMIDDYLTRKKTYNDHIVNLLFCANRWEFASFIQEQLEQGITLIVDRYAFSGVA
YATAKGASMTLSKSYESGLPKPDLVIFLESGSKEINRNVGEEIYEDVAFQQKVLQEYKKMIEEGEDIHWQIISSEFEEDVKKELIKNIVIEAIHTVTGPV
GQLWM
205
Not Available
Not Available
01-02-1994
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Poxvirus TMP kinase is able to phosphorylate dTMP, dUMP and also dGMP from any purine and pyrimidine nucleoside triphosphate. The large substrate specificity is explained by the presence of a canal connecting the edge of the dimer interface to the TMP base binding pocket, canal not found in the human homolog (By similarity).
2.7.4.9  
GO:0004798  ;   GO:0005524  ;   GO:0006233  ;   GO:0006235  
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available